Friday Dec 5, 2025
NEWSLETTER
www.israelhayom.com
  • Home
  • News
    • Israel
    • Israel at War
    • Middle East
    • United States
  • Opinions
  • Jewish World
    • Archaeology
    • Antisemitism
  • Lifestyle
    • Food
    • Travel
    • Fashion
    • Culture
  • Magazine
    • Feature
    • Analysis
    • Explainer
  • In Memoriam
www.israelhayom.com
  • Home
  • News
    • Israel
    • Israel at War
    • Middle East
    • United States
  • Opinions
  • Jewish World
    • Archaeology
    • Antisemitism
  • Lifestyle
    • Food
    • Travel
    • Fashion
    • Culture
  • Magazine
    • Feature
    • Analysis
    • Explainer
  • In Memoriam
www.israelhayom.com
Home Science & Technology Startup Nation Startup Close-up

Israeli alt-milk startup hopes new eco facility will help cows enjoy 'early retirement'

Remilk, which produces animal-free dairy-identical milk proteins plans to build 750,000 square-foot precision fermentation facility at The Symbiosis project in Kalundborg, Denmark.

by  Noga Martin/ILH Startup Editor
Published on  04-27-2022 08:36
Last modified: 04-27-2022 08:39
Israeli alt-milk startup hopes new eco facility will help cows enjoy 'early retirement'Remilk

"Remilk is committed to reinventing our dairy industry in a kind, sustainable way." says founder and CEO Aviv Wolff | Courtesy: Remilk

Share on FacebookShare on Twitter

Following the close of $120 million in Series B funding, Israeli foodtech startup Remilk, which produces animal-free dairy-identical milk proteins through precision fermentation, will be building a full-scale precision fermentation facility in Kalundborg, Denmark, the company announced Tuesday.

Follow Israel Hayom on Facebook, Twitter, and Instagram

The facility is planned to extend over 750,000 square feet of newly acquired land within The Symbiosis project, a pioneering sustainable industrial ecosystem, in Kalundborg.

Kalundborg's Symbiosis project is an industrial ecosystem in which byproducts of one company become resources for another. At present, Symbiosis is a collaborative effort involving more than a dozen visionary public and private companies including industry giants such as Novozymes, Novo Nordisk and Chr. Hansen.

At the new facility, Remilk plans to produce non-animal dairy protein for use in products like cheese, yogurt, and ice cream, in volumes equivalent to that produced by 50,000 cows each year.

"Remilk is committed to reinventing our dairy industry in a kind, sustainable way. Eliminating the need for animals in our food system is the only way to supply our world's growing demand without destroying it in the process," said Remilk founder and CEO Aviv Wolff.

"We intend to massively scale up our production capabilities to make nutritious, delicious, and affordable dairy that will send cows into early retirement," he added.

According to Wolff, Remilk isn't just "dreaming big, we're acting upon our promise to dramatically reduce the food industry's devastating impact on our planet. Ending animals' historic role as providers of food for humankind is one of the most powerful measures we can take to reduce our impact on this planet."

The selection of this location was made possible through a partnership with the city of Kalundborg, Invest in Denmark (Ministry of Foreign Affairs of Denmark), the Danish Embassy in Israel, and the Israeli Embassy in Denmark.

Kalundborg Mayor Martin Damm said, "The Municipality of Kalundborg looks forward to welcoming the international company Remilk. The company's profile fits perfectly into our sustainability profile and with the Biotech City's other participants."

"When Remilk's plant for production of non-animal dairy products is completed, it will also be the world's largest precision fermentation facility. I see Remilk's choice of Kalundborg Municipality as a buy-in to our commitment to sustainability, high technology and education and our ability to enter a constructive dialogue with our stakeholders," Damm said.

"I am very happy to welcome Remilk to Denmark. This investment is a recognition of Denmark's position as a global leader in sustainable food production and innovation," said Anne Hougaard Jensen, director of Invest in Denmark at the Danish Ministry of Foreign Affairs.

Subscribe to Israel Hayom's daily newsletter and never miss our top stories!

Tags: animal rightscruelty-freedairymilkveganvegetarian

Related Posts

Free platform helps prospective parents fulfill their dreamGetty Images/iStockphoto

Free platform helps prospective parents fulfill their dream

by Noga Martin/ILH Startup Editor

Israeli-founded GoStork matches individuals and couples struggling to conceive with the best providers of fertility treatments for them.

Israeli startup designs smart workout gear to keep athletes injury-freeCourtesy

Israeli startup designs smart workout gear to keep athletes injury-free

by Sofia Rubinson and Dahlia Kraus

Haifa-based Tropx has developed athletic clothing with sensors that analyze athletes' form and points out what needs to be corrected...

Zero-waste alt-protein production platform uses 'the whole plant'Liron Almog

Zero-waste alt-protein production platform uses 'the whole plant'

by Noga Martin/ILH Startup Editor

Israeli foodtech startup Gavan Technologies is developing a method of producing protein, as well as natural pigments, gluten substitutes, and...

Menu

Analysis 

Archaeology

Blogpost

Business & Finance

Culture

Exclusive

Explainer

Environment

 

Features

Health

In Brief

Jewish World

Judea and Samaria

Lifestyle

Cyber & Internet

Sports

 

Diplomacy 

Iran & The Gulf

Gaza Strip

Politics

Shopping

Terms of use

Privacy Policy

Submissions

Contact Us

About Us

The first issue of Israel Hayom appeared on July 30, 2007. Israel Hayom was founded on the belief that the Israeli public deserves better, more balanced and more accurate journalism. Journalism that speaks, not shouts. Journalism of a different kind. And free of charge.

All rights reserved to Israel Hayom

Hosted by sPD.co.il

  • Home
  • News
    • Israel at War
    • Israel
    • United States
    • Middle East
    • Sports
  • Opinions
  • Jewish World
    • Archaeology
    • Antisemitism
  • Lifestyle
    • Food
    • Travel
    • Fashion
    • Culture
  • Magazine
    • Feature
    • Analysis
    • Explainer
    • Environment & Wildlife
    • Health & Wellness
  • In Memoriam
  • Subscribe to Newsletter
  • Submit your opinion
  • Terms and conditions

All rights reserved to Israel Hayom

Hosted by sPD.co.il

Newsletter

[contact-form-7 id=”508379″ html_id=”isrh_form_Newsletter_en” title=”newsletter_subscribe”]

  • Home
  • News
    • Israel at War
    • Israel
    • United States
    • Middle East
    • Sports
  • Opinions
  • Jewish World
    • Archaeology
    • Antisemitism
  • Lifestyle
    • Food
    • Travel
    • Fashion
    • Culture
  • Magazine
    • Feature
    • Analysis
    • Explainer
    • Environment & Wildlife
    • Health & Wellness
  • In Memoriam
  • Subscribe to Newsletter
  • Submit your opinion
  • Terms and conditions

All rights reserved to Israel Hayom

Hosted by sPD.co.il